(data stored in ACNUC29543 zone)

EMBL: CT978603.PE380

CT978603.PE380       Location/Qualifiers
FT   CDS             363824..363979
FT                   /transl_table=11
FT                   /gene="SynRCC307_0380"
FT                   /locus_tag="SynRCC307_0380"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27283"
FT                   /db_xref="GOA:A5GQX4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX4"
FT                   /protein_id="CAK27283.1"
FT                   /translation="MLKRLEAVMALVVTAGLAVVSYWLFFSWAQGGGSQREPLTTPVPQ
FT                   ERSADS"
     MLKRLEAVMA LVVTAGLAVV SYWLFFSWAQ GGGSQREPLT TPVPQERSAD S                 51
//

If you have problems or comments...

PBIL Back to PBIL home page