(data stored in ACNUC29543 zone)

EMBL: CT978603.PE382

CT978603.PE382       Location/Qualifiers
FT   CDS             complement(364231..364683)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0382"
FT                   /locus_tag="SynRCC307_0382"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27285"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX6"
FT                   /protein_id="CAK27285.1"
FT                   /translation="MFPFSLDSVASYIWRHSQTEAPASQASCSSQSRPWDSCDHLSGPA
FT                   LTNRPSRGELVHPAHNTSMLSAAVASATQPIALQAECTGSEQMVSFQTPLPGNLAQAMS
FT                   QFIEAHPQWDQYRLMQAALAGFLLQQGVQQRDLTRRYVSSMFGRRV"
     MFPFSLDSVA SYIWRHSQTE APASQASCSS QSRPWDSCDH LSGPALTNRP SRGELVHPAH        60
     NTSMLSAAVA SATQPIALQA ECTGSEQMVS FQTPLPGNLA QAMSQFIEAH PQWDQYRLMQ       120
     AALAGFLLQQ GVQQRDLTRR YVSSMFGRRV                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page