(data stored in ACNUC29543 zone)

EMBL: CT978603.PE383

CT978603.PE383       Location/Qualifiers
FT   CDS             complement(364835..365095)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0383"
FT                   /locus_tag="SynRCC307_0383"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27286"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQX7"
FT                   /protein_id="CAK27286.1"
FT                   /translation="MRMLMEPAIPAMAASADKSDVLVSAVMSTYLLTHLHHVLQRAEFS
FT                   ATREGRPAMARNYAKLRKVLCLDARTMRDASAMETSEDWAA"
     MRMLMEPAIP AMAASADKSD VLVSAVMSTY LLTHLHHVLQ RAEFSATREG RPAMARNYAK        60
     LRKVLCLDAR TMRDASAMET SEDWAA                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page