(data stored in ACNUC29543 zone)

EMBL: CT978603.PE386

CT978603.PE386       Location/Qualifiers
FT   CDS             complement(366543..367214)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0386"
FT                   /locus_tag="SynRCC307_0386"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27289"
FT                   /db_xref="GOA:A5GQY0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY0"
FT                   /protein_id="CAK27289.1"
FT                   /translation="MCHDQKDTLSTVMALQLGDTVPNFTQDSQQGPINFYDYAGDSWVV
FT                   LFSHPADYTPVCTTELGAVAKLRAEWDKRNVKTIALSVDSAESHKGWIGDINETQCTVV
FT                   DYPILADEDKTVSDLYGMIHPKALNNLTVRSVFVIDPAKKLRLQITYPASTGRNFDEIL
FT                   RVIDSLQLTDHHQVATPVNWKDGEDCVVVPSIPTDEARNKFPKGVTEVRPYLRMTPQPN
FT                   R"
     MCHDQKDTLS TVMALQLGDT VPNFTQDSQQ GPINFYDYAG DSWVVLFSHP ADYTPVCTTE        60
     LGAVAKLRAE WDKRNVKTIA LSVDSAESHK GWIGDINETQ CTVVDYPILA DEDKTVSDLY       120
     GMIHPKALNN LTVRSVFVID PAKKLRLQIT YPASTGRNFD EILRVIDSLQ LTDHHQVATP       180
     VNWKDGEDCV VVPSIPTDEA RNKFPKGVTE VRPYLRMTPQ PNR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page