(data stored in ACNUC29543 zone)

EMBL: CT978603.PE393

CT978603.PE393       Location/Qualifiers
FT   CDS             372013..372672
FT                   /transl_table=11
FT                   /gene="SynRCC307_0393"
FT                   /locus_tag="SynRCC307_0393"
FT                   /product="4'-phosphopantetheinyl transferase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27296"
FT                   /db_xref="GOA:A5GQY7"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY7"
FT                   /protein_id="CAK27296.1"
FT                   /translation="MAAMQSGSEPKQPQLWCGLLPGCSDDRLASLLSAQELAWGEALPQ
FT                   RRRLIFWQTRAVVRQQLAAWLGCTPEAVPLLAPPAHYPQLAAGWGYVSWSHSGEQLLLG
FT                   WSPQPVGVDLEPADRPIRADSLWRRLCPGEPPPAALADAVLQRWVALEALTKRRCSSIA
FT                   VELGRWSWQLEQGRAVHRGDQHNVDVVAQRHHLQQRSWWLGWSGGAMPAVALEEGG"
     MAAMQSGSEP KQPQLWCGLL PGCSDDRLAS LLSAQELAWG EALPQRRRLI FWQTRAVVRQ        60
     QLAAWLGCTP EAVPLLAPPA HYPQLAAGWG YVSWSHSGEQ LLLGWSPQPV GVDLEPADRP       120
     IRADSLWRRL CPGEPPPAAL ADAVLQRWVA LEALTKRRCS SIAVELGRWS WQLEQGRAVH       180
     RGDQHNVDVV AQRHHLQQRS WWLGWSGGAM PAVALEEGG                              219
//

If you have problems or comments...

PBIL Back to PBIL home page