(data stored in ACNUC29543 zone)

EMBL: CT978603.PE396

CT978603.PE396       Location/Qualifiers
FT   CDS             complement(373996..376155)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0396"
FT                   /locus_tag="SynRCC307_0396"
FT                   /product="ATPase related to the helicase subunit of the
FT                   Holliday junction resolvase"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27299"
FT                   /db_xref="GOA:A5GQZ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ0"
FT                   /protein_id="CAK27299.1"
FT                   /translation="MWFMDLFGHHADQQLQQQAPLAERLRPRSLDEFIGQDAILGPGRL
FT                   LRRAIAADRLGSLILHGPPGTGKTTLARIIANTTRCHFSSLNAVLAGIKDLRAEVEQAQ
FT                   ERLGRHGLRTLLFIDEVHRFNTSQQDALLPWVENGTVTLIGATTENPFFEVNKALVSRS
FT                   RLFRLQSLDQAALHQVLDRALSDRTHGYGERSIQLDAEARAHLVEVAGGDARSLLNALE
FT                   LAVETTDANASGAIQITLAVAEESIQQQAVLYDKQGDAHFDTISAFIKSIRGSDPDAAL
FT                   FWLARMVEAGEDPRFIFRRLLISAGEDIGLADPQGIVVVEACATAFDRIGLPEGLYPLV
FT                   QATLYLAGASKSNSALGFFDAVKQLRQEKAQQIPKHLRDANRDGSAFGDGVGYRYPHAY
FT                   ADHWVAQQYLPNALQGQVFYQPGSLGWEGERRQQLLTHRAAQLAAAVEWDSQQGEPLSS
FT                   GPDDPAVERWLQRQLALEEGRLVRLQQRFWHAIGLQRHHNVLVMGSRSLLWALPALSGT
FT                   PEGGVTLQLESSADIERIKAQLQVLDPLQQPALIEAPAHAVEGLGDERFELLIGRNLLQ
FT                   GANQRALKAWVKQLETLLYDNAEIHLMSSQPQAGPAELLNSDHPPLVEAEQGWLAKRQP
FT                   LEQLQQLLAAANWSVTKEQWTDQVSLQVDSGLITRWFSKQATYRQAMEGQLGVQAIKAL
FT                   KESYQKRIGTKLRQTISHQHLVARR"
     MWFMDLFGHH ADQQLQQQAP LAERLRPRSL DEFIGQDAIL GPGRLLRRAI AADRLGSLIL        60
     HGPPGTGKTT LARIIANTTR CHFSSLNAVL AGIKDLRAEV EQAQERLGRH GLRTLLFIDE       120
     VHRFNTSQQD ALLPWVENGT VTLIGATTEN PFFEVNKALV SRSRLFRLQS LDQAALHQVL       180
     DRALSDRTHG YGERSIQLDA EARAHLVEVA GGDARSLLNA LELAVETTDA NASGAIQITL       240
     AVAEESIQQQ AVLYDKQGDA HFDTISAFIK SIRGSDPDAA LFWLARMVEA GEDPRFIFRR       300
     LLISAGEDIG LADPQGIVVV EACATAFDRI GLPEGLYPLV QATLYLAGAS KSNSALGFFD       360
     AVKQLRQEKA QQIPKHLRDA NRDGSAFGDG VGYRYPHAYA DHWVAQQYLP NALQGQVFYQ       420
     PGSLGWEGER RQQLLTHRAA QLAAAVEWDS QQGEPLSSGP DDPAVERWLQ RQLALEEGRL       480
     VRLQQRFWHA IGLQRHHNVL VMGSRSLLWA LPALSGTPEG GVTLQLESSA DIERIKAQLQ       540
     VLDPLQQPAL IEAPAHAVEG LGDERFELLI GRNLLQGANQ RALKAWVKQL ETLLYDNAEI       600
     HLMSSQPQAG PAELLNSDHP PLVEAEQGWL AKRQPLEQLQ QLLAAANWSV TKEQWTDQVS       660
     LQVDSGLITR WFSKQATYRQ AMEGQLGVQA IKALKESYQK RIGTKLRQTI SHQHLVARR        719
//

If you have problems or comments...

PBIL Back to PBIL home page