(data stored in ACNUC29543 zone)

EMBL: CT978603.PE397

CT978603.PE397       Location/Qualifiers
FT   CDS             376209..377411
FT                   /transl_table=11
FT                   /gene="SynRCC307_0397"
FT                   /locus_tag="SynRCC307_0397"
FT                   /product="Possible membrane-fusion protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27300"
FT                   /db_xref="GOA:A5GQZ1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ1"
FT                   /protein_id="CAK27300.1"
FT                   /translation="MDGSVRLFRGLIVLALCPLAGCSWLGSQGPKPLQVSTAVLQPEQF
FT                   RELGDYVATLEAVNQVQLAALADGRVVELPVEEGQQVEQGEVLLRLSSEERQAELIQAQ
FT                   AELSRRRADVAAVQADLERDRRNFERYRYLAKEGAANALDLDSFKASFLASQAKLEANQ
FT                   DLVEAAEAGLGVARTRLDYKTVRAPISGQVSDLSVKLGDVVKERDPFTAIVRNDRLYTQ
FT                   ITIPVTMAERTKPGLPVWLLDPTNGIELAKGELKFVDPDVKVATQGLLAKAEFSNPGNR
FT                   LRSGMRVRTLVGFGSSRQLAVPFDAVIRSAGQSFVYVIGPASELNAKQRQHFKQLKDDT
FT                   PVALKRAVSLGPLQNSCYPVLSGLEPGEQLISSHLLSLRQGTAVKAKASSLEVPICRPL
FT                   R"
     MDGSVRLFRG LIVLALCPLA GCSWLGSQGP KPLQVSTAVL QPEQFRELGD YVATLEAVNQ        60
     VQLAALADGR VVELPVEEGQ QVEQGEVLLR LSSEERQAEL IQAQAELSRR RADVAAVQAD       120
     LERDRRNFER YRYLAKEGAA NALDLDSFKA SFLASQAKLE ANQDLVEAAE AGLGVARTRL       180
     DYKTVRAPIS GQVSDLSVKL GDVVKERDPF TAIVRNDRLY TQITIPVTMA ERTKPGLPVW       240
     LLDPTNGIEL AKGELKFVDP DVKVATQGLL AKAEFSNPGN RLRSGMRVRT LVGFGSSRQL       300
     AVPFDAVIRS AGQSFVYVIG PASELNAKQR QHFKQLKDDT PVALKRAVSL GPLQNSCYPV       360
     LSGLEPGEQL ISSHLLSLRQ GTAVKAKASS LEVPICRPLR                             400
//

If you have problems or comments...

PBIL Back to PBIL home page