(data stored in ACNUC29543 zone)

EMBL: CT978603.PE398

CT978603.PE398       Location/Qualifiers
FT   CDS             377461..378549
FT                   /transl_table=11
FT                   /gene="SynRCC307_0398"
FT                   /locus_tag="SynRCC307_0398"
FT                   /product="Possible membrane-fusion protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27301"
FT                   /db_xref="GOA:A5GQZ2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ2"
FT                   /protein_id="CAK27301.1"
FT                   /translation="MAAARRNRIRLSVMVWLAVLAGCQSPKPPAVRGHVELIAPKQFRF
FT                   QEQATYQSTLESISNVAMAAEIDGRITSMPMQQGQQVQPGDLLFTLDQVQQRAQVDAAA
FT                   AEARKTRVNANRYIFLNDQGAVSTKDRDYYVTQAIESADRLRADQATLDYKNVVAPIAG
FT                   QVGSIQHKLGSVVSQGETIVNIVDNSKLWVRLDVPSELAYRLRLGMPVVLKAPGLPADL
FT                   PEGEVSFIAPSLDRSSQTVLVKATFDNPNGVLRDQQRVAAVLSFGSNSLLSVPVGAVLL
FT                   QAGQTFVFTAVPAAKAQKQLGRELKPKPAKGDLVAVQTQVGLGTLQDGRYPVLKGLDGT
FT                   EKVVMGNLAQLRSGMVLPVTGQ"
     MAAARRNRIR LSVMVWLAVL AGCQSPKPPA VRGHVELIAP KQFRFQEQAT YQSTLESISN        60
     VAMAAEIDGR ITSMPMQQGQ QVQPGDLLFT LDQVQQRAQV DAAAAEARKT RVNANRYIFL       120
     NDQGAVSTKD RDYYVTQAIE SADRLRADQA TLDYKNVVAP IAGQVGSIQH KLGSVVSQGE       180
     TIVNIVDNSK LWVRLDVPSE LAYRLRLGMP VVLKAPGLPA DLPEGEVSFI APSLDRSSQT       240
     VLVKATFDNP NGVLRDQQRV AAVLSFGSNS LLSVPVGAVL LQAGQTFVFT AVPAAKAQKQ       300
     LGRELKPKPA KGDLVAVQTQ VGLGTLQDGR YPVLKGLDGT EKVVMGNLAQ LRSGMVLPVT       360
     GQ                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page