(data stored in ACNUC29543 zone)

EMBL: CT978603.PE400

CT978603.PE400       Location/Qualifiers
FT   CDS             381839..382120
FT                   /transl_table=11
FT                   /gene="SynRCC307_0400"
FT                   /locus_tag="SynRCC307_0400"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27303"
FT                   /db_xref="GOA:A5GQZ4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ4"
FT                   /protein_id="CAK27303.1"
FT                   /translation="MPLPHPTGYRPRQQSRVDRRRIVLAGMLFGFFAVLLMVLGHRAAR
FT                   APGSSLKTMSLDHVLVVMFGVGFCGSWGETMRQLSLVARSRQTRNSLE"
     MPLPHPTGYR PRQQSRVDRR RIVLAGMLFG FFAVLLMVLG HRAARAPGSS LKTMSLDHVL        60
     VVMFGVGFCG SWGETMRQLS LVARSRQTRN SLE                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page