(data stored in ACNUC29543 zone)

EMBL: CT978603.PE401

CT978603.PE401       Location/Qualifiers
FT   CDS             complement(382109..382948)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0401"
FT                   /locus_tag="SynRCC307_0401"
FT                   /product="Possible ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27304"
FT                   /db_xref="GOA:A5GQZ5"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ5"
FT                   /protein_id="CAK27304.1"
FT                   /translation="MAPRASRLLPSLSRRQLQRVVLEADTPGGRLYNLIIFGTILLSVV
FT                   GLLLEPQPLSFSRELQRGGAVVWIDGFCLLVFLIDYLLHVALSPQPWRYIRSFYGVIDL
FT                   IAVLFFMVPQISSGVVLWMFKFGRILRVFKLLRFVDEADRLLISLRASARRIAVFILFV
FT                   VILQVFLGYLMVLVESGHPNSQFQSVGQGVYWAVVTMTTVGYGDVVPQTVLGRLLAAAV
FT                   MLLGFGIIAIPTGIVSYEAIRQGQNDQRQCSHCGYRGHRHGAEFCDRCGTLLPTSLQ"
     MAPRASRLLP SLSRRQLQRV VLEADTPGGR LYNLIIFGTI LLSVVGLLLE PQPLSFSREL        60
     QRGGAVVWID GFCLLVFLID YLLHVALSPQ PWRYIRSFYG VIDLIAVLFF MVPQISSGVV       120
     LWMFKFGRIL RVFKLLRFVD EADRLLISLR ASARRIAVFI LFVVILQVFL GYLMVLVESG       180
     HPNSQFQSVG QGVYWAVVTM TTVGYGDVVP QTVLGRLLAA AVMLLGFGII AIPTGIVSYE       240
     AIRQGQNDQR QCSHCGYRGH RHGAEFCDRC GTLLPTSLQ                              279
//

If you have problems or comments...

PBIL Back to PBIL home page