(data stored in ACNUC29543 zone)

EMBL: CT978603.PE404

CT978603.PE404       Location/Qualifiers
FT   CDS             complement(385021..385464)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0404"
FT                   /locus_tag="SynRCC307_0404"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27307"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQZ8"
FT                   /protein_id="CAK27307.1"
FT                   /translation="MSGLLQNAAAIAVVPLLTLIAGSGLAQTSPDPLAEPLTREELKPT
FT                   YFAIVECARRNQEPGCLAARQLADELMDRPFVTAFCKDTAFAVTQQAKTAEMNSFERKD
FT                   ELVRLARDTMDLCKGKEDPRPVYGELDENKTNDNKINVLDLLN"
     MSGLLQNAAA IAVVPLLTLI AGSGLAQTSP DPLAEPLTRE ELKPTYFAIV ECARRNQEPG        60
     CLAARQLADE LMDRPFVTAF CKDTAFAVTQ QAKTAEMNSF ERKDELVRLA RDTMDLCKGK       120
     EDPRPVYGEL DENKTNDNKI NVLDLLN                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page