(data stored in ACNUC29543 zone)

EMBL: CT978603.PE410

CT978603.PE410       Location/Qualifiers
FT   CDS             complement(392080..393432)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0410"
FT                   /locus_tag="SynRCC307_0410"
FT                   /product="Phosphatidylcholine-hydrolyzing phospholipase D
FT                   family protein"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27313"
FT                   /db_xref="GOA:A5GR04"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR04"
FT                   /protein_id="CAK27313.1"
FT                   /translation="MHRLSALALAALCSGCTAAAQYRPWPEATLPQPEFITAGFNHRLG
FT                   SSYISPLTGQRRDGDNLEQQLITAIAGAQREVLVAVQELTLPAIAEALIERHRAGVTVK
FT                   LVLENNYSAPWSLQHPAGLEPHQQKRLRRLQKLGWRDAIALLQHAGVPLLDDTADGSAG
FT                   SGLMHHKFVVIDRQRLLTGSANFTSSGLHGDAGQASSRGNVNHLLQLESPELAELFAEE
FT                   FEQLWGDGPGGKPDSRFGLGKHSRQLQQAQLGSDRAGVLFAPHRRNNPDHGLALIRQQL
FT                   EQAQRSIDLALFVFSAQELADVLALKRDQGVQIRVLVDPGFAHRSYSEWLDLKGLAMAD
FT                   HRCRLEAGNNPWATPLKNVGTPRLSRGDKLHHKFAVIDGQTVITGSFNWSPAAAHTNDE
FT                   TLLVIDSPTLAAHFSREMDRLWQSAELGITPRLQRKLERSQRLCGQSQIAD"
     MHRLSALALA ALCSGCTAAA QYRPWPEATL PQPEFITAGF NHRLGSSYIS PLTGQRRDGD        60
     NLEQQLITAI AGAQREVLVA VQELTLPAIA EALIERHRAG VTVKLVLENN YSAPWSLQHP       120
     AGLEPHQQKR LRRLQKLGWR DAIALLQHAG VPLLDDTADG SAGSGLMHHK FVVIDRQRLL       180
     TGSANFTSSG LHGDAGQASS RGNVNHLLQL ESPELAELFA EEFEQLWGDG PGGKPDSRFG       240
     LGKHSRQLQQ AQLGSDRAGV LFAPHRRNNP DHGLALIRQQ LEQAQRSIDL ALFVFSAQEL       300
     ADVLALKRDQ GVQIRVLVDP GFAHRSYSEW LDLKGLAMAD HRCRLEAGNN PWATPLKNVG       360
     TPRLSRGDKL HHKFAVIDGQ TVITGSFNWS PAAAHTNDET LLVIDSPTLA AHFSREMDRL       420
     WQSAELGITP RLQRKLERSQ RLCGQSQIAD                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page