(data stored in ACNUC29543 zone)

EMBL: CT978603.PE423

CT978603.PE423       Location/Qualifiers
FT   CDS             402836..403930
FT                   /transl_table=11
FT                   /gene="SynRCC307_0423"
FT                   /locus_tag="SynRCC307_0423"
FT                   /product="Predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptak"
FT                   /note="DNA replication, recombination, and repair /
FT                   Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27326"
FT                   /db_xref="GOA:A5GR17"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR17"
FT                   /protein_id="CAK27326.1"
FT                   /translation="MIVGRRSWWWTWLQVPGVGISRIKQLEQAFGSLQAAWWAPAEQLL
FT                   ALPGVGPSLLAGRDQLQQRASALPLPVPPKVLLPSDLAMPPALMALPQPPAALFWCGRG
FT                   ALWPLLRRQQAIAVIGSRRASPYGCRWAQQLGVALAAAGWPVISGLAEGVDAQAHQGCL
FT                   EAGGTPIAVLGTSLERVYPRHHQRLQSQVGRRGLLISEQAPGAPGLRGAFAKRNRLLVA
FT                   MAQAVVLVECPQRSGALLAAQIAWSLQRPLWVVPADSDRASAAGSNGWLNQGATALLDP
FT                   TQLVEALGPGPLQPLALPQRPDPSPLLSALGSGASFEALQRRLHLSPGALAQQLLHHQQ
FT                   QGWIEALPGLCWRPRHTEIDLPVA"
     MIVGRRSWWW TWLQVPGVGI SRIKQLEQAF GSLQAAWWAP AEQLLALPGV GPSLLAGRDQ        60
     LQQRASALPL PVPPKVLLPS DLAMPPALMA LPQPPAALFW CGRGALWPLL RRQQAIAVIG       120
     SRRASPYGCR WAQQLGVALA AAGWPVISGL AEGVDAQAHQ GCLEAGGTPI AVLGTSLERV       180
     YPRHHQRLQS QVGRRGLLIS EQAPGAPGLR GAFAKRNRLL VAMAQAVVLV ECPQRSGALL       240
     AAQIAWSLQR PLWVVPADSD RASAAGSNGW LNQGATALLD PTQLVEALGP GPLQPLALPQ       300
     RPDPSPLLSA LGSGASFEAL QRRLHLSPGA LAQQLLHHQQ QGWIEALPGL CWRPRHTEID       360
     LPVA                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page