(data stored in ACNUC29543 zone)

EMBL: CT978603.PE434

CT978603.PE434       Location/Qualifiers
FT   CDS             complement(410768..411073)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0434"
FT                   /locus_tag="SynRCC307_0434"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27337"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR28"
FT                   /protein_id="CAK27337.1"
FT                   /translation="MMPLLLLPVFWAQLQQPCRIWSVREALSYSGLCDVRKQQGTTSLT
FT                   APNELTGEDQTIEVSPKGRRQVHVRGLNSQGDETLWGEARKVGKSCWVGSDFGLCL"
     MMPLLLLPVF WAQLQQPCRI WSVREALSYS GLCDVRKQQG TTSLTAPNEL TGEDQTIEVS        60
     PKGRRQVHVR GLNSQGDETL WGEARKVGKS CWVGSDFGLC L                           101
//

If you have problems or comments...

PBIL Back to PBIL home page