(data stored in ACNUC29543 zone)

EMBL: CT978603.PE435

CT978603.PE435       Location/Qualifiers
FT   CDS             complement(411070..411846)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0435"
FT                   /locus_tag="SynRCC307_0435"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27338"
FT                   /db_xref="InterPro:IPR024981"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR29"
FT                   /protein_id="CAK27338.1"
FT                   /translation="MGHNGSDFGLGLPVLKRSAMAKAAAALLACTAITPFTLPAAAQSS
FT                   RVARPLSEAAAQQAADQILEAVRQRDGALRYSQFSKALQTTSSPSMVQGTLDQLPQLES
FT                   WTIQSVRTGLSGNSSVEVLLQSENGSREATLVINPQGRLVAQLFNVSDKDSTKVARAFI
FT                   DAVSDGQFISARSLLALDLQKEISPQKLQNKWLRLQQTTGNFQAIEKVMEAEHGSNGSL
FT                   VLVTMRFNRTTDNIFVILNPAGQITGLDFPIDGAVR"
     MGHNGSDFGL GLPVLKRSAM AKAAAALLAC TAITPFTLPA AAQSSRVARP LSEAAAQQAA        60
     DQILEAVRQR DGALRYSQFS KALQTTSSPS MVQGTLDQLP QLESWTIQSV RTGLSGNSSV       120
     EVLLQSENGS REATLVINPQ GRLVAQLFNV SDKDSTKVAR AFIDAVSDGQ FISARSLLAL       180
     DLQKEISPQK LQNKWLRLQQ TTGNFQAIEK VMEAEHGSNG SLVLVTMRFN RTTDNIFVIL       240
     NPAGQITGLD FPIDGAVR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page