(data stored in ACNUC29543 zone)

EMBL: CT978603.PE44

CT978603.PE44        Location/Qualifiers
FT   CDS             41510..41815
FT                   /transl_table=11
FT                   /gene="SynRCC307_0044"
FT                   /locus_tag="SynRCC307_0044"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26947"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY8"
FT                   /protein_id="CAK26947.1"
FT                   /translation="MNKCEKILKSTRSGACGVPWPLARGGRIKRKRTMASLASVHPQSC
FT                   PYTPLSNRRGFVDSGHQIEKLEFALAVAVGRGDQQRIHELRQRIADLGDNREEPGT"
     MNKCEKILKS TRSGACGVPW PLARGGRIKR KRTMASLASV HPQSCPYTPL SNRRGFVDSG        60
     HQIEKLEFAL AVAVGRGDQQ RIHELRQRIA DLGDNREEPG T                           101
//

If you have problems or comments...

PBIL Back to PBIL home page