(data stored in ACNUC29543 zone)

EMBL: CT978603.PE440

CT978603.PE440       Location/Qualifiers
FT   CDS             414765..415334
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="SynRCC307_0440"
FT                   /product="Chromate transport protein ChrA"
FT                   /note="Possible HGT"
FT                   /note="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27343"
FT                   /db_xref="GOA:A5GR34"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR34"
FT                   /protein_id="CAK27343.1"
FT                   /translation="MVDPSSAWDTWLQVVWTFLRLSLFSLGGGNTLLAEYHHLSVERFG
FT                   WITSSQFADIYALAEAAPGPSSMIVGLLGLGAGWDHGLGWGLLCGVSAEVAVLLPSTVV
FT                   MVAAALSWNRLKDAPIRTAFERGLGPITLGILFHVGLTVLRTADHSVVAYLVSAVVCAL
FT                   MLFTRISPLYFMAVAGVLGAIGVIPS"
     MVDPSSAWDT WLQVVWTFLR LSLFSLGGGN TLLAEYHHLS VERFGWITSS QFADIYALAE        60
     AAPGPSSMIV GLLGLGAGWD HGLGWGLLCG VSAEVAVLLP STVVMVAAAL SWNRLKDAPI       120
     RTAFERGLGP ITLGILFHVG LTVLRTADHS VVAYLVSAVV CALMLFTRIS PLYFMAVAGV       180
     LGAIGVIPS                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page