(data stored in ACNUC29543 zone)

EMBL: CT978603.PE447

CT978603.PE447       Location/Qualifiers
FT   CDS             complement(420433..421986)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0447"
FT                   /locus_tag="SynRCC307_0447"
FT                   /product="Neutral invertase-like protein"
FT                   /EC_number="3.2.1.36"
FT                   /note="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27350"
FT                   /db_xref="GOA:A5GR41"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR41"
FT                   /protein_id="CAK27350.1"
FT                   /translation="MGAPAIPKVPRSPSKSEHTTRPNSGESEVVRQAEELFEQTLVNVR
FT                   GQLAGAVAALESSVHDSELNYGEIFLRDNVPVMVYLLLRGRFEIVRHFLDLCLELQSRS
FT                   YRTRGVFPTSFVEEDDKILADYGQRSIGRITSVDASLWWPVLCWMYVRASGDTSYGTSP
FT                   KVQRAVQLLLDLVLQPSFYEPPVLFVPDCAFMIDRPMDVWGAPLEVEVLLFGCLKSCCQ
FT                   LMSLVEGGGHGGPLIQQRLELTRTWMRDLRVYLLNHYWVTSKTMQVLRRRPTEQYGDYQ
FT                   SRNEFNVQPEVIPHWLQEWLDDRGGYLIGNMRTGRPDFRFYSLGNALGSLFGLLTGPQQ
FT                   LALFRLVIHNRQHLMAEMPMRICHPPMDQDEWITNTGMDPKNWPWSYHNGGHWPSLLWP
FT                   MAAAVLMHQRLYPNDDLLLLGQTRTMLEECYWQQLNQLPRQQWAEYFDGPTGTWVGQQA
FT                   RINQTWTIVGFLLLHHLMRKAPQDVKLLDLDDVGPLRLSFQDQHEKSSTDERKSFLKNY
FT                   "
     MGAPAIPKVP RSPSKSEHTT RPNSGESEVV RQAEELFEQT LVNVRGQLAG AVAALESSVH        60
     DSELNYGEIF LRDNVPVMVY LLLRGRFEIV RHFLDLCLEL QSRSYRTRGV FPTSFVEEDD       120
     KILADYGQRS IGRITSVDAS LWWPVLCWMY VRASGDTSYG TSPKVQRAVQ LLLDLVLQPS       180
     FYEPPVLFVP DCAFMIDRPM DVWGAPLEVE VLLFGCLKSC CQLMSLVEGG GHGGPLIQQR       240
     LELTRTWMRD LRVYLLNHYW VTSKTMQVLR RRPTEQYGDY QSRNEFNVQP EVIPHWLQEW       300
     LDDRGGYLIG NMRTGRPDFR FYSLGNALGS LFGLLTGPQQ LALFRLVIHN RQHLMAEMPM       360
     RICHPPMDQD EWITNTGMDP KNWPWSYHNG GHWPSLLWPM AAAVLMHQRL YPNDDLLLLG       420
     QTRTMLEECY WQQLNQLPRQ QWAEYFDGPT GTWVGQQARI NQTWTIVGFL LLHHLMRKAP       480
     QDVKLLDLDD VGPLRLSFQD QHEKSSTDER KSFLKNY                                517
//

If you have problems or comments...

PBIL Back to PBIL home page