(data stored in ACNUC29543 zone)

EMBL: CT978603.PE45

CT978603.PE45        Location/Qualifiers
FT   CDS             41919..42158
FT                   /transl_table=11
FT                   /gene="SynRCC307_0045"
FT                   /locus_tag="SynRCC307_0045"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26948"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY9"
FT                   /protein_id="CAK26948.1"
FT                   /translation="MLTQIRSSDVRETSQGNGSIDQERDQLKLQAQGFYDAAKVKAEAG
FT                   EVSEAGLLILKGLDCERRAKAKGPQVLGLIRKRG"
     MLTQIRSSDV RETSQGNGSI DQERDQLKLQ AQGFYDAAKV KAEAGEVSEA GLLILKGLDC        60
     ERRAKAKGPQ VLGLIRKRG                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page