(data stored in ACNUC29543 zone)

EMBL: CT978603.PE452

CT978603.PE452       Location/Qualifiers
FT   CDS             424514..425566
FT                   /transl_table=11
FT                   /gene="SynRCC307_0452"
FT                   /locus_tag="SynRCC307_0452"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27355"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR46"
FT                   /protein_id="CAK27355.1"
FT                   /translation="MVATPASLEAPTLHLDLPDPEQDDLSTLEFHARLEQAWELCDRFD
FT                   LQTEIWRGRILAAVRDREKRGGEGRGAGFLQWLREREISKTRAYSLIQLAESANSLVGD
FT                   GLLEESSVNNFSKRAFVETAQADPEVQQMISEAANEGQQITRKQVRRLTDEFTAATSPL
FT                   LPDEIRERTQQNLLPPKAVAPLVRELARLPEPQQEDLRRVLKEEPELDRIKDVTATARW
FT                   LSKAAEAGMAVRALQHESIDLEKAMQEATRLDMLGLVADVVGQAQQLEQAVLKLHTSWR
FT                   RLGGLHERLWLESGSSTPYLRSLLQGLETLSGSNLRVSLGELAGGKRLRLQLVEEGADQ
FT                   LEAPPLQQAA"
     MVATPASLEA PTLHLDLPDP EQDDLSTLEF HARLEQAWEL CDRFDLQTEI WRGRILAAVR        60
     DREKRGGEGR GAGFLQWLRE REISKTRAYS LIQLAESANS LVGDGLLEES SVNNFSKRAF       120
     VETAQADPEV QQMISEAANE GQQITRKQVR RLTDEFTAAT SPLLPDEIRE RTQQNLLPPK       180
     AVAPLVRELA RLPEPQQEDL RRVLKEEPEL DRIKDVTATA RWLSKAAEAG MAVRALQHES       240
     IDLEKAMQEA TRLDMLGLVA DVVGQAQQLE QAVLKLHTSW RRLGGLHERL WLESGSSTPY       300
     LRSLLQGLET LSGSNLRVSL GELAGGKRLR LQLVEEGADQ LEAPPLQQAA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page