(data stored in ACNUC29543 zone)

EMBL: CT978603.PE454

CT978603.PE454       Location/Qualifiers
FT   CDS             complement(427053..427685)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0454"
FT                   /locus_tag="SynRCC307_0454"
FT                   /product="LysM-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27357"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR48"
FT                   /protein_id="CAK27357.1"
FT                   /translation="MVRPSNYSLVMRKSLLALLVVMAALPARAQEGVHVMQPKQTLYAV
FT                   SRMYGVPVKTLLQINNFANPNKIKVGTAIRLPAGTKAVNSPATTLATQSVPESTAPTTT
FT                   ETAVVTTVESEDDDTAVLAKKTPTTDWRYFGPLQVDWNNWRTMAGSLVAPTLNKQKQPL
FT                   YVAVNCGARKLNITGSGGTWKTWESPAEAFERDLVKAACADPKIGKG"
     MVRPSNYSLV MRKSLLALLV VMAALPARAQ EGVHVMQPKQ TLYAVSRMYG VPVKTLLQIN        60
     NFANPNKIKV GTAIRLPAGT KAVNSPATTL ATQSVPESTA PTTTETAVVT TVESEDDDTA       120
     VLAKKTPTTD WRYFGPLQVD WNNWRTMAGS LVAPTLNKQK QPLYVAVNCG ARKLNITGSG       180
     GTWKTWESPA EAFERDLVKA ACADPKIGKG                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page