(data stored in ACNUC29543 zone)

EMBL: CT978603.PE461

CT978603.PE461       Location/Qualifiers
FT   CDS             432668..432988
FT                   /transl_table=11
FT                   /gene="SynRCC307_0461"
FT                   /locus_tag="SynRCC307_0461"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27364"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR55"
FT                   /protein_id="CAK27364.1"
FT                   /translation="MAGGAAMGLIDLQLAEATPVNGLWSELVERLGAERAQLACRQALD
FT                   LQSMRGEAVSLPVLLVETCGVGLIERQQLRRETGLPVPEGEGMVLLFSRPRLQFQLMQL
FT                   QR"
     MAGGAAMGLI DLQLAEATPV NGLWSELVER LGAERAQLAC RQALDLQSMR GEAVSLPVLL        60
     VETCGVGLIE RQQLRRETGL PVPEGEGMVL LFSRPRLQFQ LMQLQR                      106
//

If you have problems or comments...

PBIL Back to PBIL home page