(data stored in ACNUC29543 zone)

EMBL: CT978603.PE463

CT978603.PE463       Location/Qualifiers
FT   CDS             434010..434609
FT                   /transl_table=11
FT                   /gene="SynRCC307_0463"
FT                   /locus_tag="SynRCC307_0463"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27366"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR57"
FT                   /protein_id="CAK27366.1"
FT                   /translation="MAMRVLVLAAAFVLAGAPALGQPAEVILLRHGDKDRQRGDYNLSP
FT                   RGFRRAINLGRLLPACFGPIQRIGSYRLAVESEKNARSYQTAVPLAVATGLNIKMFTDS
FT                   ADGTPYDGAELLQAGWAQGKTVVLFWEHRRMPALAMALGWDGMGAIGKDDFDGLYRLRY
FT                   TPGNFLPDVIVSRESELFQQACFVNATSPLPAVPLP"
     MAMRVLVLAA AFVLAGAPAL GQPAEVILLR HGDKDRQRGD YNLSPRGFRR AINLGRLLPA        60
     CFGPIQRIGS YRLAVESEKN ARSYQTAVPL AVATGLNIKM FTDSADGTPY DGAELLQAGW       120
     AQGKTVVLFW EHRRMPALAM ALGWDGMGAI GKDDFDGLYR LRYTPGNFLP DVIVSRESEL       180
     FQQACFVNAT SPLPAVPLP                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page