(data stored in ACNUC29543 zone)

EMBL: CT978603.PE466

CT978603.PE466       Location/Qualifiers
FT   CDS             435710..437068
FT                   /transl_table=11
FT                   /gene="SynRCC307_0466"
FT                   /locus_tag="SynRCC307_0466"
FT                   /product="GTP-binding protein engA"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27369"
FT                   /db_xref="GOA:A5GR60"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR60"
FT                   /protein_id="CAK27369.1"
FT                   /translation="MALPVVAIIGRPNVGKSTLVNRLCRSRDAIVHDEPGVTRDRTYQE
FT                   GFWGGRTFRVVDTGGLVFDDDSEFLPEIREQASLAMAEACVALVIVDGQQGLTAADEAI
FT                   AAWLRQQKCPVLLGVNKCESPEQGLAMAAEFWALGLGEPKPISAIHGAGTGDLLDQVLD
FT                   FLPPQDEEEAPEPIQMAIVGRPNVGKSSLLNTVCGENRAIVSPIRGTTRDTIDTSIERE
FT                   GQSWKLLDTAGIRRRRSVNYGPEFFGINRSFKAIERSDVCVLVIDAEEGVTEQDQRLAG
FT                   RIEEEGRACLVVVNKWDLVEKDSHTMPAMEKELRSKLYFLEWAPMLFISALTGQRVERI
FT                   FPLAVLAVEQHRRRVTTAVVNEVLQEALSWRSPPTTRGGRQGRLYYGTQVAVRPPSFTL
FT                   FVNEPKLFGDTYRRYVERQIRQGLGFEGSPVRLFWRGKQQRDAERDQARAASR"
     MALPVVAIIG RPNVGKSTLV NRLCRSRDAI VHDEPGVTRD RTYQEGFWGG RTFRVVDTGG        60
     LVFDDDSEFL PEIREQASLA MAEACVALVI VDGQQGLTAA DEAIAAWLRQ QKCPVLLGVN       120
     KCESPEQGLA MAAEFWALGL GEPKPISAIH GAGTGDLLDQ VLDFLPPQDE EEAPEPIQMA       180
     IVGRPNVGKS SLLNTVCGEN RAIVSPIRGT TRDTIDTSIE REGQSWKLLD TAGIRRRRSV       240
     NYGPEFFGIN RSFKAIERSD VCVLVIDAEE GVTEQDQRLA GRIEEEGRAC LVVVNKWDLV       300
     EKDSHTMPAM EKELRSKLYF LEWAPMLFIS ALTGQRVERI FPLAVLAVEQ HRRRVTTAVV       360
     NEVLQEALSW RSPPTTRGGR QGRLYYGTQV AVRPPSFTLF VNEPKLFGDT YRRYVERQIR       420
     QGLGFEGSPV RLFWRGKQQR DAERDQARAA SR                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page