(data stored in ACNUC29543 zone)

EMBL: CT978603.PE468

CT978603.PE468       Location/Qualifiers
FT   CDS             437967..438233
FT                   /transl_table=11
FT                   /gene="SynRCC307_0468"
FT                   /locus_tag="SynRCC307_0468"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27371"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR62"
FT                   /protein_id="CAK27371.1"
FT                   /translation="MSVERYLNHPTFGMLYRVCPVATGEEIYATLYAQRMFFRVTSQPQ
FT                   GTSFEAMPFSDARHHAEQNLLRLRRNQSPELPLWKKLFDQTFI"
     MSVERYLNHP TFGMLYRVCP VATGEEIYAT LYAQRMFFRV TSQPQGTSFE AMPFSDARHH        60
     AEQNLLRLRR NQSPELPLWK KLFDQTFI                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page