(data stored in ACNUC29543 zone)

EMBL: CT978603.PE469

CT978603.PE469       Location/Qualifiers
FT   CDS             438237..438875
FT                   /transl_table=11
FT                   /gene="SynRCC307_0469"
FT                   /locus_tag="SynRCC307_0469"
FT                   /product="Predicted enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27372"
FT                   /db_xref="GOA:A5GR63"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR63"
FT                   /protein_id="CAK27372.1"
FT                   /translation="MGSLAQRYEAILQELPPGVKLLAVSKGRSAAEIRALYGLGQRSFG
FT                   ESRVQEAALKQQELADLADIDWQFIGRLQANKVRPVLKAFTTIHAVDSFNLAARVSRIA
FT                   GELGLCPQLYLQLKLRPDANKAGLSWAEAQSLWPQLQNLPHVHWQGVMVIPPRELAEQD
FT                   LGALFAEAVGHADALGLAGRSMGMSGDWPLAAQQGSTVVRVGSALFGSD"
     MGSLAQRYEA ILQELPPGVK LLAVSKGRSA AEIRALYGLG QRSFGESRVQ EAALKQQELA        60
     DLADIDWQFI GRLQANKVRP VLKAFTTIHA VDSFNLAARV SRIAGELGLC PQLYLQLKLR       120
     PDANKAGLSW AEAQSLWPQL QNLPHVHWQG VMVIPPRELA EQDLGALFAE AVGHADALGL       180
     AGRSMGMSGD WPLAAQQGST VVRVGSALFG SD                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page