(data stored in ACNUC29543 zone)

EMBL: CT978603.PE47

CT978603.PE47        Location/Qualifiers
FT   CDS             complement(42834..44024)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0047"
FT                   /locus_tag="SynRCC307_0047"
FT                   /product="DHSS soluble hydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26950"
FT                   /db_xref="GOA:A5GPZ1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ1"
FT                   /protein_id="CAK26950.1"
FT                   /translation="MIHQPDSGPPPSGMKDKLQLMIPGPTPVPERVLLAMARHPIGHRS
FT                   GEFQQIVARTTEQLQWLHQTKGDVLVLAGSGTAAMEAGIINVLSRGDKVICGDNGKFGE
FT                   RWVKVAKAYGLEVEVIKAEWGQPLDPEAFRNALEADTAKAIKAVILTHSETSTGVINDL
FT                   ETINRHVKAHGEALIVVDAVTSLGACSVPVDAWGLDVVCSGSQKGYMIPPGLGFVAMGE
FT                   RAWAAQKQSDLPKFYLDLERYRKAAAGNSNPFTPPVNLYFALEAALDLMQDEGLEAIFA
FT                   RHDRHRRASQAAMRALGLPLFAADGYGSPAITAVAPAGLDAEALRKAVKGRYDILLAGG
FT                   QDHLKGKVFRIGHLGFVCDRDVLTAVAAIEGALADLGVASAQPGAGVAAAAAVLQG"
     MIHQPDSGPP PSGMKDKLQL MIPGPTPVPE RVLLAMARHP IGHRSGEFQQ IVARTTEQLQ        60
     WLHQTKGDVL VLAGSGTAAM EAGIINVLSR GDKVICGDNG KFGERWVKVA KAYGLEVEVI       120
     KAEWGQPLDP EAFRNALEAD TAKAIKAVIL THSETSTGVI NDLETINRHV KAHGEALIVV       180
     DAVTSLGACS VPVDAWGLDV VCSGSQKGYM IPPGLGFVAM GERAWAAQKQ SDLPKFYLDL       240
     ERYRKAAAGN SNPFTPPVNL YFALEAALDL MQDEGLEAIF ARHDRHRRAS QAAMRALGLP       300
     LFAADGYGSP AITAVAPAGL DAEALRKAVK GRYDILLAGG QDHLKGKVFR IGHLGFVCDR       360
     DVLTAVAAIE GALADLGVAS AQPGAGVAAA AAVLQG                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page