(data stored in ACNUC29543 zone)

EMBL: CT978603.PE472

CT978603.PE472       Location/Qualifiers
FT   CDS             complement(440319..440921)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0472"
FT                   /locus_tag="SynRCC307_0472"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27375"
FT                   /db_xref="GOA:A5GR66"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR66"
FT                   /protein_id="CAK27375.1"
FT                   /translation="MNPLAILVVPLGYLLGSFPSGYLAGRWCAGVDIRQLGSGSTGATN
FT                   VLRQVGKGPALVVFLVDVFKGSAAVILARALLGAGAYGWLVAAGLAALAGHIWPIWLGG
FT                   KGGKAVATGFGMLLGLVPAVGMACLGVFLTSLALSRIVSISSVLAAAALPLLMAGAGAP
FT                   GAYLGLGVVAAVMVIWRHRSNLSRLLKGEEPRLGQKD"
     MNPLAILVVP LGYLLGSFPS GYLAGRWCAG VDIRQLGSGS TGATNVLRQV GKGPALVVFL        60
     VDVFKGSAAV ILARALLGAG AYGWLVAAGL AALAGHIWPI WLGGKGGKAV ATGFGMLLGL       120
     VPAVGMACLG VFLTSLALSR IVSISSVLAA AALPLLMAGA GAPGAYLGLG VVAAVMVIWR       180
     HRSNLSRLLK GEEPRLGQKD                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page