(data stored in ACNUC29543 zone)

EMBL: CT978603.PE474

CT978603.PE474       Location/Qualifiers
FT   CDS             441764..441937
FT                   /transl_table=11
FT                   /gene="SynRCC307_0474"
FT                   /locus_tag="SynRCC307_0474"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27377"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR68"
FT                   /protein_id="CAK27377.1"
FT                   /translation="MQGQLLPARFRRWGAFHCAMCSSLQCDSGADGHREHEEIVGLCQS
FT                   RAEPLYDLFPSP"
     MQGQLLPARF RRWGAFHCAM CSSLQCDSGA DGHREHEEIV GLCQSRAEPL YDLFPSP           57
//

If you have problems or comments...

PBIL Back to PBIL home page