(data stored in ACNUC29543 zone)

EMBL: CT978603.PE476

CT978603.PE476       Location/Qualifiers
FT   CDS             complement(442102..442509)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0476"
FT                   /locus_tag="SynRCC307_0476"
FT                   /product="Uncharacterized conserved membrane protein
FT                   specific to cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27379"
FT                   /db_xref="GOA:A5GR70"
FT                   /db_xref="InterPro:IPR021467"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR70"
FT                   /protein_id="CAK27379.1"
FT                   /translation="MADTELQPRFWVPLGVVGLGLACGLLSWIAAAVVVLFGLFLMLQT
FT                   ALLRLRFEAEALVVTRSGTEIRRFPYSDWMGWQVFWPMVPVLFYFREVKSIHFLPMLFD
FT                   ANALNEQLTTRIGPSGTRLKEAAPPADAPHE"
     MADTELQPRF WVPLGVVGLG LACGLLSWIA AAVVVLFGLF LMLQTALLRL RFEAEALVVT        60
     RSGTEIRRFP YSDWMGWQVF WPMVPVLFYF REVKSIHFLP MLFDANALNE QLTTRIGPSG       120
     TRLKEAAPPA DAPHE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page