(data stored in ACNUC29543 zone)

EMBL: CT978603.PE480

CT978603.PE480       Location/Qualifiers
FT   CDS             446873..447514
FT                   /transl_table=11
FT                   /gene="SynRCC307_0480"
FT                   /locus_tag="SynRCC307_0480"
FT                   /product="Conserved hypothetical protein specific to
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27383"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR74"
FT                   /protein_id="CAK27383.1"
FT                   /translation="MDGMGIAALGSGLWAFPPSRDSDGGTAWLFHSQSGASVLVDVPLL
FT                   SDEHLSWLQQQPRGWIVLTHRQGHGRCRRLQEQLGWPVLVQEQEAYLLPTLQQRHSFGE
FT                   QRELEPGLQLLWTPGPTPGSCCLHWSQGRRDVLFCGRLLWPRGLEDVEMRIGDSTFHAT
FT                   RQQRSVGRLRTWLDAGQPAQIACAAGLGVLRGAKLVERGSVAIDTLIARN"
     MDGMGIAALG SGLWAFPPSR DSDGGTAWLF HSQSGASVLV DVPLLSDEHL SWLQQQPRGW        60
     IVLTHRQGHG RCRRLQEQLG WPVLVQEQEA YLLPTLQQRH SFGEQRELEP GLQLLWTPGP       120
     TPGSCCLHWS QGRRDVLFCG RLLWPRGLED VEMRIGDSTF HATRQQRSVG RLRTWLDAGQ       180
     PAQIACAAGL GVLRGAKLVE RGSVAIDTLI ARN                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page