(data stored in ACNUC29543 zone)

EMBL: CT978603.PE483

CT978603.PE483       Location/Qualifiers
FT   CDS             448905..449189
FT                   /transl_table=11
FT                   /gene="SynRCC307_0483"
FT                   /locus_tag="SynRCC307_0483"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27386"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR77"
FT                   /protein_id="CAK27386.1"
FT                   /translation="MLTSAAFLKEVFGIIGPGIIHTGINKTRVPMGSPAKHTKQETCTA
FT                   CGGSGMLRQGCDSYRTCLVCMGVGTVAVHDQEPVTVPAEMLSASSFAAK"
     MLTSAAFLKE VFGIIGPGII HTGINKTRVP MGSPAKHTKQ ETCTACGGSG MLRQGCDSYR        60
     TCLVCMGVGT VAVHDQEPVT VPAEMLSASS FAAK                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page