(data stored in ACNUC29543 zone)

EMBL: CT978603.PE484

CT978603.PE484       Location/Qualifiers
FT   CDS             449186..449527
FT                   /transl_table=11
FT                   /gene="SynRCC307_0484"
FT                   /locus_tag="SynRCC307_0484"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27387"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR78"
FT                   /protein_id="CAK27387.1"
FT                   /translation="MKKAVTATTMASGTAVKSSRMTAVQSVYMAMFGSAQVRHIVGLGV
FT                   LLLLAAAGPAQAGIDFTGCTSGPDGSITCNTEPTGNTLTDDIDARYGLDDEASPGWSEY
FT                   EPYQGFDGE"
     MKKAVTATTM ASGTAVKSSR MTAVQSVYMA MFGSAQVRHI VGLGVLLLLA AAGPAQAGID        60
     FTGCTSGPDG SITCNTEPTG NTLTDDIDAR YGLDDEASPG WSEYEPYQGF DGE              113
//

If you have problems or comments...

PBIL Back to PBIL home page