(data stored in ACNUC29543 zone)

EMBL: CT978603.PE485

CT978603.PE485       Location/Qualifiers
FT   CDS             complement(449538..450239)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0485"
FT                   /locus_tag="SynRCC307_0485"
FT                   /product="Predicted kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27388"
FT                   /db_xref="GOA:A5GR79"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR79"
FT                   /protein_id="CAK27388.1"
FT                   /translation="MTHSALSLLQQWCRERSSNGDIVLGLCAPPGSGKSHLSRQIGSGV
FT                   VAVSIDDLYWPQPKLQQHQRGLPGSHDVPRLAQLIDEFRAQGQTLVPRFDKTLAGGAGD
FT                   RVDDQPHQGDQLLLEGWCIGARGLPSLQDYQAIWRRLDALLVLVPPTHNHVLRWRLQAE
FT                   ARQRRRGGGALHAHAVTRMVQSFYSALPPERCFQPLLDSPQLPTWSLKLDHRRRPIGSI
FT                   QPCQTGVGSDP"
     MTHSALSLLQ QWCRERSSNG DIVLGLCAPP GSGKSHLSRQ IGSGVVAVSI DDLYWPQPKL        60
     QQHQRGLPGS HDVPRLAQLI DEFRAQGQTL VPRFDKTLAG GAGDRVDDQP HQGDQLLLEG       120
     WCIGARGLPS LQDYQAIWRR LDALLVLVPP THNHVLRWRL QAEARQRRRG GGALHAHAVT       180
     RMVQSFYSAL PPERCFQPLL DSPQLPTWSL KLDHRRRPIG SIQPCQTGVG SDP              233
//

If you have problems or comments...

PBIL Back to PBIL home page