(data stored in ACNUC29543 zone)

EMBL: CT978603.PE494

CT978603.PE494       Location/Qualifiers
FT   CDS             complement(456565..456843)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0494"
FT                   /locus_tag="SynRCC307_0494"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27397"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR88"
FT                   /protein_id="CAK27397.1"
FT                   /translation="MMSESAELLDHLLEAVGAVACSAQSPTHRAAAHKAMGEALQILQS
FT                   APIAALNGIQPQHSAQPSELEGGWHIGVVERSPKQAMAGTHTKQAQP"
     MMSESAELLD HLLEAVGAVA CSAQSPTHRA AAHKAMGEAL QILQSAPIAA LNGIQPQHSA        60
     QPSELEGGWH IGVVERSPKQ AMAGTHTKQA QP                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page