(data stored in ACNUC29543 zone)

EMBL: CT978603.PE496

CT978603.PE496       Location/Qualifiers
FT   CDS             457144..458022
FT                   /transl_table=11
FT                   /gene="SynRCC307_0496"
FT                   /locus_tag="SynRCC307_0496"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27399"
FT                   /db_xref="GOA:A5GR90"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR90"
FT                   /protein_id="CAK27399.1"
FT                   /translation="MSLSRNSAHQAVLDSASAVLLQALSSPSPAPRLSAIRAPRIGSSF
FT                   HRFRSTAFQGLCHGRFIARGWVVLTSVSVLFNLKERLQSLRMLKGLGQFLQHPDDLQSV
FT                   YAVAASVQGSPMAAQMMRHMLSEPGIAAMIQEQWRPAAIDLDALEQLPAGSLGQCYASQ
FT                   LKAQGITPETLIDPAPITNDQDFIVHRLKETHDIVHVLTGFGVDGVGEIGLQAFNLAQN
FT                   RSPLAVLLIFGGMLKTLQDDQPLEALLHAISRGFEMGLKAECVVGYKLEDGWQRPLSEW
FT                   RAELKLPQALA"
     MSLSRNSAHQ AVLDSASAVL LQALSSPSPA PRLSAIRAPR IGSSFHRFRS TAFQGLCHGR        60
     FIARGWVVLT SVSVLFNLKE RLQSLRMLKG LGQFLQHPDD LQSVYAVAAS VQGSPMAAQM       120
     MRHMLSEPGI AAMIQEQWRP AAIDLDALEQ LPAGSLGQCY ASQLKAQGIT PETLIDPAPI       180
     TNDQDFIVHR LKETHDIVHV LTGFGVDGVG EIGLQAFNLA QNRSPLAVLL IFGGMLKTLQ       240
     DDQPLEALLH AISRGFEMGL KAECVVGYKL EDGWQRPLSE WRAELKLPQA LA               292
//

If you have problems or comments...

PBIL Back to PBIL home page