(data stored in ACNUC29543 zone)

EMBL: CT978603.PE498

CT978603.PE498       Location/Qualifiers
FT   CDS             complement(458668..458970)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0498"
FT                   /locus_tag="SynRCC307_0498"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27401"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR92"
FT                   /protein_id="CAK27401.1"
FT                   /translation="MRKRFFAGVTEKSRFDFPLRGFSRNPDLPLQLLTSDWGNDEGMTE
FT                   ITYQKLLAAWRFEVVRTQGGVLFIGPNHFFSLPHEPRTKAERKIAIAHIRSLCKL"
     MRKRFFAGVT EKSRFDFPLR GFSRNPDLPL QLLTSDWGND EGMTEITYQK LLAAWRFEVV        60
     RTQGGVLFIG PNHFFSLPHE PRTKAERKIA IAHIRSLCKL                             100
//

If you have problems or comments...

PBIL Back to PBIL home page