(data stored in ACNUC29543 zone)

EMBL: CT978603.PE50

CT978603.PE50        Location/Qualifiers
FT   CDS             46803..47570
FT                   /transl_table=11
FT                   /gene="SynRCC307_0050"
FT                   /locus_tag="SynRCC307_0050"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26953"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ4"
FT                   /protein_id="CAK26953.1"
FT                   /translation="MIECVPGGRDHRDLAVARGATAWVAHLESAALVKPGNALPAPIPS
FT                   GTDRRVVASSAPLQQNPQLQRRLQQDSIELAGKTIYLNPFLYWRRFDANTDRWLREPGQ
FT                   LNEDQISTNRVRFYPEVVWDSLSDEERAIKDGSVEMFLKSLELISTFNPELTAGQLLEL
FT                   ERKMAVTKKKAFEHWVGKSLRRRSQEEKAEKRRFSRQRWVREWREWLADPTTGRALLPL
FT                   TGLILTAGFLGWHLGSQQFCRELILQPGVQRSR"
     MIECVPGGRD HRDLAVARGA TAWVAHLESA ALVKPGNALP APIPSGTDRR VVASSAPLQQ        60
     NPQLQRRLQQ DSIELAGKTI YLNPFLYWRR FDANTDRWLR EPGQLNEDQI STNRVRFYPE       120
     VVWDSLSDEE RAIKDGSVEM FLKSLELIST FNPELTAGQL LELERKMAVT KKKAFEHWVG       180
     KSLRRRSQEE KAEKRRFSRQ RWVREWREWL ADPTTGRALL PLTGLILTAG FLGWHLGSQQ       240
     FCRELILQPG VQRSR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page