(data stored in ACNUC29543 zone)

EMBL: CT978603.PE502

CT978603.PE502       Location/Qualifiers
FT   CDS             460493..460663
FT                   /transl_table=11
FT                   /gene="SynRCC307_0502"
FT                   /locus_tag="SynRCC307_0502"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27405"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR96"
FT                   /protein_id="CAK27405.1"
FT                   /translation="MMNAMACVVNPLAPLETPMGSRPRPLHDLAHESHDQFWEKECAER
FT                   PNALGCRLFDD"
     MMNAMACVVN PLAPLETPMG SRPRPLHDLA HESHDQFWEK ECAERPNALG CRLFDD            56
//

If you have problems or comments...

PBIL Back to PBIL home page