(data stored in ACNUC29543 zone)

EMBL: CT978603.PE503

CT978603.PE503       Location/Qualifiers
FT   CDS             460706..460912
FT                   /transl_table=11
FT                   /gene="SynRCC307_0503"
FT                   /locus_tag="SynRCC307_0503"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27406"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR97"
FT                   /protein_id="CAK27406.1"
FT                   /translation="MNVFPSVMNQSLPQDMASQPSLQLVQPEDFSHGMVSVGAQIAELN
FT                   SLTDLVANLEQDALTGGADFVGK"
     MNVFPSVMNQ SLPQDMASQP SLQLVQPEDF SHGMVSVGAQ IAELNSLTDL VANLEQDALT        60
     GGADFVGK                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page