(data stored in ACNUC29543 zone)

EMBL: CT978603.PE507

CT978603.PE507       Location/Qualifiers
FT   CDS             complement(461597..461803)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0507"
FT                   /locus_tag="SynRCC307_0507"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27410"
FT                   /db_xref="GOA:A5GRA1"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA1"
FT                   /protein_id="CAK27410.1"
FT                   /translation="MLADLLRIILAFFLPPLAVATQVGVQASAFWLNLIFWLLSFGGLG
FT                   LPVLAIMWPVAVIHALYIIITRK"
     MLADLLRIIL AFFLPPLAVA TQVGVQASAF WLNLIFWLLS FGGLGLPVLA IMWPVAVIHA        60
     LYIIITRK                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page