(data stored in ACNUC29543 zone)

EMBL: CT978603.PE511

CT978603.PE511       Location/Qualifiers
FT   CDS             complement(463202..463453)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0511"
FT                   /locus_tag="SynRCC307_0511"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27414"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA5"
FT                   /protein_id="CAK27414.1"
FT                   /translation="MDQSLATASTRFNLKSLVHSEVPMERQPSDIRQTLFFSASSMGVE
FT                   AIDDCEQTFANDPSQAIAGLGAAVVSWCVMVERALWMI"
     MDQSLATAST RFNLKSLVHS EVPMERQPSD IRQTLFFSAS SMGVEAIDDC EQTFANDPSQ        60
     AIAGLGAAVV SWCVMVERAL WMI                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page