(data stored in ACNUC29543 zone)

EMBL: CT978603.PE512

CT978603.PE512       Location/Qualifiers
FT   CDS             complement(463472..463843)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0512"
FT                   /locus_tag="SynRCC307_0512"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27415"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA6"
FT                   /protein_id="CAK27415.1"
FT                   /translation="MLAMLRSAAVGLSLALLPAAGLAGLSDFDRTAERVATAICIGVHT
FT                   DASYNQAWDQGKPDALAIGLTVERIEAVKANQGVEAIQNRANEMIRDVGCQALIPEQAY
FT                   GVFGPFKPLGPSSFEGFYD"
     MLAMLRSAAV GLSLALLPAA GLAGLSDFDR TAERVATAIC IGVHTDASYN QAWDQGKPDA        60
     LAIGLTVERI EAVKANQGVE AIQNRANEMI RDVGCQALIP EQAYGVFGPF KPLGPSSFEG       120
     FYD                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page