(data stored in ACNUC29543 zone)

EMBL: CT978603.PE513

CT978603.PE513       Location/Qualifiers
FT   CDS             463971..464240
FT                   /transl_table=11
FT                   /gene="SynRCC307_0513"
FT                   /locus_tag="SynRCC307_0513"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27416"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA7"
FT                   /protein_id="CAK27416.1"
FT                   /translation="MNNPQAIPTSICAAGALLREVIQNQLHELEPLQRSKLQLALRPDC
FT                   MSEAMKESLALAVREIHGFTQHTTANLFEAVLDCGEEQEPTPGS"
     MNNPQAIPTS ICAAGALLRE VIQNQLHELE PLQRSKLQLA LRPDCMSEAM KESLALAVRE        60
     IHGFTQHTTA NLFEAVLDCG EEQEPTPGS                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page