(data stored in ACNUC29543 zone)

EMBL: CT978603.PE514

CT978603.PE514       Location/Qualifiers
FT   CDS             464299..464646
FT                   /transl_table=11
FT                   /gene="SynRCC307_0514"
FT                   /locus_tag="SynRCC307_0514"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA8"
FT                   /protein_id="CAK27417.1"
FT                   /translation="MPESGPDPYVQFLENWIPGIGECTELHDKLHEHFELDFSVNSEAR
FT                   LLGFQLGHHPAGNFLHVMIFAVISTLLYPSPYRNDWSGLRDFFRSYVLGKNFQLISYWF
FT                   IPRGILAWRSL"
     MPESGPDPYV QFLENWIPGI GECTELHDKL HEHFELDFSV NSEARLLGFQ LGHHPAGNFL        60
     HVMIFAVIST LLYPSPYRND WSGLRDFFRS YVLGKNFQLI SYWFIPRGIL AWRSL            115
//

If you have problems or comments...

PBIL Back to PBIL home page