(data stored in ACNUC29543 zone)

EMBL: CT978603.PE517

CT978603.PE517       Location/Qualifiers
FT   CDS             465393..465851
FT                   /transl_table=11
FT                   /gene="SynRCC307_0517"
FT                   /locus_tag="SynRCC307_0517"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB1"
FT                   /protein_id="CAK27420.1"
FT                   /translation="MGASDVLIGDLAMKTASSIGIGCLAVAAAFFSLELLTATASASPT
FT                   AGPMRIATTPLLLWRRQEQLSDQQREALFQAQRRWKQTSYSSRAALMQQEKQCVDRATS
FT                   KLAFKRCLKQTRQSRSALREQYYAYINPIRQELGLAPLEWVERRSPRR"
     MGASDVLIGD LAMKTASSIG IGCLAVAAAF FSLELLTATA SASPTAGPMR IATTPLLLWR        60
     RQEQLSDQQR EALFQAQRRW KQTSYSSRAA LMQQEKQCVD RATSKLAFKR CLKQTRQSRS       120
     ALREQYYAYI NPIRQELGLA PLEWVERRSP RR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page