(data stored in ACNUC29543 zone)

EMBL: CT978603.PE518

CT978603.PE518       Location/Qualifiers
FT   CDS             465872..466138
FT                   /transl_table=11
FT                   /gene="SynRCC307_0518"
FT                   /locus_tag="SynRCC307_0518"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27421"
FT                   /db_xref="InterPro:IPR012663"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB2"
FT                   /protein_id="CAK27421.1"
FT                   /translation="MTKLAQHWTSVEEQLGFRHFRVVGQGGRSAERWVELVAVLDATQR
FT                   LRLPLRDLRDPALWMSGLQPVVEDMPSDPALEAQGSEQEPLPK"
     MTKLAQHWTS VEEQLGFRHF RVVGQGGRSA ERWVELVAVL DATQRLRLPL RDLRDPALWM        60
     SGLQPVVEDM PSDPALEAQG SEQEPLPK                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page