(data stored in ACNUC29543 zone)

EMBL: CT978603.PE52

CT978603.PE52        Location/Qualifiers
FT   CDS             47822..49621
FT                   /transl_table=11
FT                   /gene="SynRCC307_0052"
FT                   /locus_tag="SynRCC307_0052"
FT                   /product="Cell division protein FtsI / penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26955"
FT                   /db_xref="GOA:A5GPZ6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ6"
FT                   /protein_id="CAK26955.1"
FT                   /translation="MSLGFSRRDARFCGMGQQPGVILLVLLMFFSAIGMRLVWMQLLHG
FT                   AENRVAADENRIRLMPRSPIRGRLLDRKGRVLASSKLTYTLFIEPRLVTDEQWPALRDR
FT                   LAALLQLDPKGLDQARERGTGKDGYRIPLVNGLQPEQVLRFQEQNLDLPGASVDMDILR
FT                   YYPHGMLASHTLGYTQPITEDEYDVLIDKGYKIRDRIGRIGVEAAYESHLRGKWGGQML
FT                   EVNANGEVQRYLGDRPSKAGKDLILTIDLDLQRAAEKALADKRGGAIVAMNPTTGAILA
FT                   MASKPNFDPNFFSKLITTQQEYDALFKSPNKPLFSRAMNAYNPGSTWKVVTGMAGMESG
FT                   KFPAGTKLQTMGCITYGGHCFPDHNGAGFGTIGYEDALRFSSNTFFYQVGVGVGSRELY
FT                   KSAKLLGFDAPSGIEIGYEESPGLVGNEDWANEGRGWAEPGTTPWIPEDMASASIGQSI
FT                   VEITPLQLARAYSVFANGGYLVTPHLADQGQDWTAPPLRTKVDMKPSTLETIRAGLRKV
FT                   VADGTGYGLNDPALPPGAGKTGTAEDSQRGGPDHAWFGCFSPYDNPEIVVAAFAQNTPG
FT                   GGSVHALPMAKKVLLAWHAQKAD"
     MSLGFSRRDA RFCGMGQQPG VILLVLLMFF SAIGMRLVWM QLLHGAENRV AADENRIRLM        60
     PRSPIRGRLL DRKGRVLASS KLTYTLFIEP RLVTDEQWPA LRDRLAALLQ LDPKGLDQAR       120
     ERGTGKDGYR IPLVNGLQPE QVLRFQEQNL DLPGASVDMD ILRYYPHGML ASHTLGYTQP       180
     ITEDEYDVLI DKGYKIRDRI GRIGVEAAYE SHLRGKWGGQ MLEVNANGEV QRYLGDRPSK       240
     AGKDLILTID LDLQRAAEKA LADKRGGAIV AMNPTTGAIL AMASKPNFDP NFFSKLITTQ       300
     QEYDALFKSP NKPLFSRAMN AYNPGSTWKV VTGMAGMESG KFPAGTKLQT MGCITYGGHC       360
     FPDHNGAGFG TIGYEDALRF SSNTFFYQVG VGVGSRELYK SAKLLGFDAP SGIEIGYEES       420
     PGLVGNEDWA NEGRGWAEPG TTPWIPEDMA SASIGQSIVE ITPLQLARAY SVFANGGYLV       480
     TPHLADQGQD WTAPPLRTKV DMKPSTLETI RAGLRKVVAD GTGYGLNDPA LPPGAGKTGT       540
     AEDSQRGGPD HAWFGCFSPY DNPEIVVAAF AQNTPGGGSV HALPMAKKVL LAWHAQKAD        599
//

If you have problems or comments...

PBIL Back to PBIL home page