(data stored in ACNUC29543 zone)

EMBL: CT978603.PE522

CT978603.PE522       Location/Qualifiers
FT   CDS             467234..467389
FT                   /transl_table=11
FT                   /gene="SynRCC307_0522"
FT                   /locus_tag="SynRCC307_0522"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27425"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB6"
FT                   /protein_id="CAK27425.1"
FT                   /translation="MVRAGMFRRPQFADALSWLLFLSVGVLTAEAEPHPGTFVFDEAHP
FT                   PQQQLW"
     MVRAGMFRRP QFADALSWLL FLSVGVLTAE AEPHPGTFVF DEAHPPQQQL W                 51
//

If you have problems or comments...

PBIL Back to PBIL home page