(data stored in ACNUC29543 zone)

EMBL: CT978603.PE526

CT978603.PE526       Location/Qualifiers
FT   CDS             complement(470150..470398)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0526"
FT                   /locus_tag="SynRCC307_0526"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27429"
FT                   /db_xref="GOA:A5GRC0"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC0"
FT                   /protein_id="CAK27429.1"
FT                   /translation="MDSKDVAIRRIRKRKKLNKQWQVYLFVNLILLLVWGLSGGGYFWP
FT                   IWVIVFWGLSLAWEQWRFDHPEKAITEQEIQDELSRM"
     MDSKDVAIRR IRKRKKLNKQ WQVYLFVNLI LLLVWGLSGG GYFWPIWVIV FWGLSLAWEQ        60
     WRFDHPEKAI TEQEIQDELS RM                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page